PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PEQU_12452
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis
Family HB-other
Protein Properties Length: 838aa    MW: 92940.8 Da    PI: 7.499
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PEQU_12452genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox16.41.5e-0573129157
                 TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
    Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                 +++R  ++++ ++ +++ F+ + ++ ++e +++++ +g+t +qV+ +F  +R k +k
  PEQU_12452  73 KKPRDLLNPKAVKYMQSIFAIKDTIGKKETRDISALCGVTITQVRDFFAGQRSKVRK 129
                 799***************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500718.58470130IPR001356Homeobox domain
SMARTSM003890.002372134IPR001356Homeobox domain
CDDcd000865.05E-473129No hitNo description
SuperFamilySSF466894.71E-673132IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.5E-473138IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009911Biological Processpositive regulation of flower development
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 838 aa     Download sequence    Send to blast
MALVPARTDN YFLDLEMDGS VESIGRLLDL QKKLFHSQIE QLQRLVTNQC KLTGINPLSQ  60
EMAAGALSIK IGKKPRDLLN PKAVKYMQSI FAIKDTIGKK ETRDISALCG VTITQVRDFF  120
AGQRSKVRKL ISLAREKAVR SDASDTANEG CSTKPEVALI CGTDTPSNAF DVKNVAESAE  180
VPASNGNLPA IQYCEHVLVS SIDAKPIQVV PPSSSSQEES IPGIDEDDKK FLENIFNLMR  240
KEGTFSGQVK LMEWILQIHN SAVLVWFLTK GSITILATWL SHAAIEEQTT VLNVILKVLF  300
HLPLHKALPA QMSTILSTLN KLRFYRTPDI SNSAWALLAR WSKILARNQT PNYPSISNSS  360
YGIQKDIIRK QRHVIYSGYF LFWISEILSD EFWRSKIGIK DEVLALTESS GNDRLFTLLF  420
SKSDSKLALK LLTASCDRSN RKQGQSALPI KIKERRKVLL VEQLDEKPAG RIAQVGKVQP  480
SNHSRPISAD DIQKAKMRKM FMQHKYRKAD ASSSENKKIE DSKDLPPAAQ SKSIFTSPRK  540
IQEAQIKIEE EKLAEALPGG GSETPVDTIS TGALQEGLLE RLKRCQFQWQ TPPEMKIDSS  600
WRVGEAESSK ELSIQAQRIR REKETFYSSE LDIPPDPKEP WDVEMDFDDS LTPEIPIEQP  660
PDADAAEEST NPPVEQAIPE NPPAAVPALP MASSGIAAEP DLELLAVLLK NPELVFALTS  720
GHGKNLTNDE RVALLDMIKH GSAAISGNVN GISSSASHEK PKEPVPMSLP SPTPPSDVER  780
MVCFQCLSSL LRFLFVPAML IQILIACRLV GGQHSPPWPK LSCRNCTSLE RFFIQSPL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010921790.10.0PREDICTED: homeobox protein LUMINIDEPENDENS-like
TrEMBLA0A0P0VCJ30.0A0A0P0VCJ3_ORYSJ; Os01g0934300 protein (Fragment)
STRINGVIT_07s0104g01580.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP80433034
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G02560.21e-125HB-other family protein